PDB Structure Fully optimized PM7 Geometry Fully optimized PM6 Geometry
Jmol._Canvas2D (Jmol) "jmolAppletPM7_PDB"[x] script 1 started FileManager.getAtomSetCollectionFromFile(../PM7_PDB/Hydrophobin_HFBII_(2B97).pdb) FileManager opening url http://openmopac.net/PM7_accuracy/PM7_PDB/Hydrophobin_HFBII_(2B97).pdb The Resolver thinks Pdb SURFACE ACTIVE PROTEIN 11-OCT-05 2B97 ULTRA-HIGH RESOLUTION STRUCTURE OF HYDROPHOBIN HFBII found biomolecule 1: A biomolecule 1: number of transforms: 1 found biomolecule 2: B biomolecule 2: number of transforms: 1 Setting space group name to C 1 2 1 Time for openFile(../PM7_PDB/Hydrophobin_HFBII_(2B97).pdb): 271 ms reading 981 atoms ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false 1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them. Default Van der Waals type for model set to Babel 981 atoms created ModelSet: autobonding; use autobond=false to not generate bonds automatically SURFACE ACTIVE PROTEIN 11-OCT-05 2B97 ULTRA-HIGH RESOLUTION STRUCTURE OF HYDROPHOBIN HFBII found biomolecule 1: A found biomolecule 2: B 992 connections deleted Standard Hbond calculation 46 hydrogen bonds measurementUnits = "angstroms" Jmol 14.4.0_2015.10.14 2015-10-14 19:01 DSSP analysis for model 1.1 - 2B97 W. Kabsch and C. Sander, Biopolymers, vol 22, 1983, pp 2577-2637 We thank Wolfgang Kabsch and Chris Sander for writing the DSSP software, and we thank the CMBI for maintaining it to the extent that it was easy to re-engineer for our purposes. At this point in time, we make no guarantee that this code gives precisely the same analysis as the code available via license from CMBI at http://swift.cmbi.ru.nl/gv/dssp All bioshapes have been deleted and must be regenerated. NOTE: Backbone amide hydrogen positions are present and will be ignored. Their positions will be approximated, as in standard DSSP analysis. Use SET dsspCalculateHydrogenAlways FALSE to not use this approximation. ------------------------------ 65.1.8: 65.1.7: 1 2 3 4 5 6 7 65.1.6: 1234567890123456789012345678901234567890123456789012345678901234567890 65.1.5: ..........................................>5555<...................... 65.1.4: .................>444<............>>>>XXXX<<<<........................ 65.1.3: .....>33<........>33<.....................>>3<<...................>33< 65.1.1: ......TT.EEEEEEEEETTTEEEEEE........HHHHHHHHHHTT.EEEEE.....EEEEEEEE.TT. 65.1.0: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGT SUMMARY: T : A:7_A:8 E : A:10_A:18 T : A:19_A:21 E : A:22_A:27 H : A:36_A:45 T : A:46_A:47 E : A:49_A:53 E : A:59_A:66 T : A:68_A:69 hermiteLevel = 4 ribbonAspectRatio = 12 Script completed Jmol script terminated loadClass J.g3d.HermiteRenderer |
Jmol._Canvas2D (Jmol) "jmolAppletPM7_OPT"[x] script 1 started FileManager.getAtomSetCollectionFromFile(../PM7_OPT/Hydrophobin_HFBII_(2B97).pdb) FileManager opening url http://openmopac.net/PM7_accuracy/PM7_OPT/Hydrophobin_HFBII_(2B97).pdb The Resolver thinks Pdb loadClass J.adapter.readers.pdb.PdbReader JSmol exec jmolAppletPM6_OPT start applet null Jmol JavaScript applet jmolAppletPM6_OPT__573056245222895__ initializing Jmol getValue debug null Jmol getValue logLevel null Jmol getValue allowjavascript null AppletRegistry.checkIn(jmolAppletPM6_OPT__573056245222895__) nographics false nographics false headless false vwrOptions: { "name":"jmolAppletPM6_OPT","applet":true,"documentBase":"http://openmopac.net/PM7_accuracy/PM7_proteins/Hydrophobin_HFBII_(2B97).html","platform":"J.awtjs2d.Platform","fullName":"jmolAppletPM6_OPT__573056245222895__","codePath":"http://openmopac.net/PM7_accuracy/PM7_proteins/../../jsmol/j2s/","display":"jmolAppletPM6_OPT_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"573056245222895","bgcolor":"#000000" } setting document base to "http://openmopac.net/PM7_accuracy/PM7_proteins/Hydrophobin_HFBII_(2B97).html" (C) 2015 Jmol Development Jmol Version: 14.4.0_2015.10.14 2015-10-14 19:01 java.vendor: Java2Script (HTML5) java.version: 2015-09-19 23:29:54 (JSmol/j2s) os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com) Access: ALL memory: 0.0/0.0 processors available: 1 useCommandThread: false appletId:jmolAppletPM6_OPT (signed) Jmol getValue emulate null defaults = "Jmol" Jmol getValue boxbgcolor null Jmol getValue bgcolor #000000 backgroundColor = "#000000" Jmol getValue ANIMFRAMECallback null Jmol getValue APPLETREADYCallback Jmol._readyCallback APPLETREADYCallback = "Jmol._readyCallback" callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY Jmol getValue ATOMMOVEDCallback null Jmol getValue CLICKCallback null Jmol getValue DRAGDROPCallback null Jmol getValue ECHOCallback null Jmol getValue ERRORCallback null Jmol getValue EVALCallback null Jmol getValue HOVERCallback null Jmol getValue IMAGECallback null Jmol getValue LOADSTRUCTCallback null Jmol getValue MEASURECallback null Jmol getValue MESSAGECallback null Jmol getValue MINIMIZATIONCallback null Jmol getValue SERVICECallback null Jmol getValue PICKCallback null Jmol getValue RESIZECallback null Jmol getValue SCRIPTCallback null Jmol getValue SYNCCallback null Jmol getValue STRUCTUREMODIFIEDCallback null Jmol getValue doTranslate null language=en_US Jmol getValue popupMenu null Jmol getValue script null Jmol getValue loadInline null Jmol getValue load null Jmol applet jmolAppletPM6_OPT__573056245222895__ ready |
Jmol._Canvas2D (Jmol) "jmolAppletPM6_OPT"[x] loadClass core.package loadClass java.lang.String loadClass core.package JSmol exec jmolAppletPM7_PDB start applet null Jmol JavaScript applet jmolAppletPM7_PDB__573056245222895__ initializing Jmol getValue debug null Jmol getValue logLevel null Jmol getValue allowjavascript null AppletRegistry.checkIn(jmolAppletPM7_PDB__573056245222895__) nographics false nographics false headless false vwrOptions: { "name":"jmolAppletPM7_PDB","applet":true,"documentBase":"http://openmopac.net/PM7_accuracy/PM7_proteins/Hydrophobin_HFBII_(2B97).html","platform":"J.awtjs2d.Platform","fullName":"jmolAppletPM7_PDB__573056245222895__","codePath":"http://openmopac.net/PM7_accuracy/PM7_proteins/../../jsmol/j2s/","display":"jmolAppletPM7_PDB_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"573056245222895","bgcolor":"#000000" } setting document base to "http://openmopac.net/PM7_accuracy/PM7_proteins/Hydrophobin_HFBII_(2B97).html" (C) 2015 Jmol Development Jmol Version: 14.4.0_2015.10.14 2015-10-14 19:01 java.vendor: Java2Script (HTML5) java.version: 2015-09-19 23:29:54 (JSmol/j2s) os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com) Access: ALL memory: 0.0/0.0 processors available: 1 useCommandThread: false appletId:jmolAppletPM7_PDB (signed) loadClass JS.ScriptManager JSmol exec jmolAppletPM7_OPT start applet null Jmol JavaScript applet jmolAppletPM7_OPT__573056245222895__ initializing Jmol getValue debug null Jmol getValue logLevel null Jmol getValue allowjavascript null AppletRegistry.checkIn(jmolAppletPM7_OPT__573056245222895__) nographics false nographics false headless false vwrOptions: { "name":"jmolAppletPM7_OPT","applet":true,"documentBase":"http://openmopac.net/PM7_accuracy/PM7_proteins/Hydrophobin_HFBII_(2B97).html","platform":"J.awtjs2d.Platform","fullName":"jmolAppletPM7_OPT__573056245222895__","codePath":"http://openmopac.net/PM7_accuracy/PM7_proteins/../../jsmol/j2s/","display":"jmolAppletPM7_OPT_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"573056245222895","bgcolor":"#000000" } setting document base to "http://openmopac.net/PM7_accuracy/PM7_proteins/Hydrophobin_HFBII_(2B97).html" (C) 2015 Jmol Development Jmol Version: 14.4.0_2015.10.14 2015-10-14 19:01 java.vendor: Java2Script (HTML5) java.version: 2015-09-19 23:29:54 (JSmol/j2s) os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com) Access: ALL memory: 0.0/0.0 processors available: 1 useCommandThread: false appletId:jmolAppletPM7_OPT (signed) Jmol getValue emulate null defaults = "Jmol" Jmol getValue boxbgcolor null Jmol getValue bgcolor #000000 backgroundColor = "#000000" Jmol getValue ANIMFRAMECallback null Jmol getValue APPLETREADYCallback Jmol._readyCallback APPLETREADYCallback = "Jmol._readyCallback" callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY Jmol getValue ATOMMOVEDCallback null Jmol getValue CLICKCallback null Jmol getValue DRAGDROPCallback null Jmol getValue ECHOCallback null Jmol getValue ERRORCallback null Jmol getValue EVALCallback null Jmol getValue HOVERCallback null Jmol getValue IMAGECallback null Jmol getValue LOADSTRUCTCallback null Jmol getValue MEASURECallback null Jmol getValue MESSAGECallback null Jmol getValue MINIMIZATIONCallback null Jmol getValue SERVICECallback null Jmol getValue PICKCallback null Jmol getValue RESIZECallback null Jmol getValue SCRIPTCallback null Jmol getValue SYNCCallback null Jmol getValue STRUCTUREMODIFIEDCallback null Jmol getValue doTranslate null language=en_US Jmol getValue popupMenu null Jmol getValue script null Jmol getValue loadInline null Jmol getValue load null Jmol applet jmolAppletPM7_OPT__573056245222895__ ready script 1 started FileManager.getAtomSetCollectionFromFile(../PM6_OPT/Hydrophobin_HFBII_(2B97).pdb) FileManager opening url http://openmopac.net/PM7_accuracy/PM6_OPT/Hydrophobin_HFBII_(2B97).pdb The Resolver thinks Pdb SURFACE ACTIVE PROTEIN 11-OCT-05 2B97 ULTRA-HIGH RESOLUTION STRUCTURE OF HYDROPHOBIN HFBII found biomolecule 1: A biomolecule 1: number of transforms: 1 found biomolecule 2: B biomolecule 2: number of transforms: 1 Setting space group name to C 1 2 1 Time for openFile(../PM6_OPT/Hydrophobin_HFBII_(2B97).pdb): 799 ms reading 981 atoms ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false 1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them. Default Van der Waals type for model set to Babel 981 atoms created ModelSet: autobonding; use autobond=false to not generate bonds automatically SURFACE ACTIVE PROTEIN 11-OCT-05 2B97 ULTRA-HIGH RESOLUTION STRUCTURE OF HYDROPHOBIN HFBII found biomolecule 1: A found biomolecule 2: B loadClass JS.CmdExt 992 connections deleted Standard Hbond calculation 74 hydrogen bonds measurementUnits = "angstroms" Jmol 14.4.0_2015.10.14 2015-10-14 19:01 DSSP analysis for model 1.1 - 2B97 W. Kabsch and C. Sander, Biopolymers, vol 22, 1983, pp 2577-2637 We thank Wolfgang Kabsch and Chris Sander for writing the DSSP software, and we thank the CMBI for maintaining it to the extent that it was easy to re-engineer for our purposes. At this point in time, we make no guarantee that this code gives precisely the same analysis as the code available via license from CMBI at http://swift.cmbi.ru.nl/gv/dssp All bioshapes have been deleted and must be regenerated. NOTE: Backbone amide hydrogen positions are present and will be ignored. Their positions will be approximated, as in standard DSSP analysis. Use SET dsspCalculateHydrogenAlways FALSE to not use this approximation. ------------------------------ 65.1.8: 65.1.7: 1 2 3 4 5 6 65.1.6: 123456789012345678901234567890123456789012345678901234567890123456 65.1.5: ..........................................>5555<.................. 65.1.4: .................>444<............>>>>XXXX<<<<.................... 65.1.3: .....>33<........>33<..............>33<...>>3<<................... 65.1.1: ......TT.EEEEEEEEETTTEEEEEE........HHHHHHHHHHTT.EEEEE.....EEEEEEE. 65.1.0: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQK 65.2.8: 65.2.7: 7 65.2.6: 7890 65.2.5: .... 65.2.4: .... 65.2.3: .... 65.2.1: .... 65.2.0: AIGT SUMMARY: T : A:7_A:8 E : A:10_A:18 T : A:19_A:21 E : A:22_A:27 H : A:36_A:45 T : A:46_A:47 E : A:49_A:53 E : A:59_A:65 hermiteLevel = 4 ribbonAspectRatio = 12 Script completed Jmol script terminated SURFACE ACTIVE PROTEIN 11-OCT-05 2B97 ULTRA-HIGH RESOLUTION STRUCTURE OF HYDROPHOBIN HFBII found biomolecule 1: A biomolecule 1: number of transforms: 1 found biomolecule 2: B biomolecule 2: number of transforms: 1 Setting space group name to C 1 2 1 Time for openFile(../PM7_OPT/Hydrophobin_HFBII_(2B97).pdb): 3335 ms reading 981 atoms ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false 1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them. Default Van der Waals type for model set to Babel 981 atoms created ModelSet: autobonding; use autobond=false to not generate bonds automatically SURFACE ACTIVE PROTEIN 11-OCT-05 2B97 ULTRA-HIGH RESOLUTION STRUCTURE OF HYDROPHOBIN HFBII found biomolecule 1: A found biomolecule 2: B Jmol getValue emulate null defaults = "Jmol" Jmol getValue boxbgcolor null Jmol getValue bgcolor #000000 backgroundColor = "#000000" Jmol getValue ANIMFRAMECallback null Jmol getValue APPLETREADYCallback Jmol._readyCallback APPLETREADYCallback = "Jmol._readyCallback" callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY Jmol getValue ATOMMOVEDCallback null Jmol getValue CLICKCallback null Jmol getValue DRAGDROPCallback null Jmol getValue ECHOCallback null Jmol getValue ERRORCallback null Jmol getValue EVALCallback null Jmol getValue HOVERCallback null Jmol getValue IMAGECallback null Jmol getValue LOADSTRUCTCallback null Jmol getValue MEASURECallback null Jmol getValue MESSAGECallback null Jmol getValue MINIMIZATIONCallback null Jmol getValue SERVICECallback null Jmol getValue PICKCallback null Jmol getValue RESIZECallback null Jmol getValue SCRIPTCallback null Jmol getValue SYNCCallback null Jmol getValue STRUCTUREMODIFIEDCallback null Jmol getValue doTranslate null language=en_US Jmol getValue popupMenu null Jmol getValue script null Jmol getValue loadInline null Jmol getValue load null Jmol applet jmolAppletPM7_PDB__573056245222895__ ready |