PDB Structure PM7 Geometry with 3 Kcal/Angstrom^2 constraint PM6 Geometry with 3 Kcal/Angstrom^2 constraint
Jmol._Canvas2D (Jmol) "jmolAppletPM7_PDB"[x] script 1 started FileManager.getAtomSetCollectionFromFile(../PM7_PDB/1RPW.pdb) FileManager opening url http://openmopac.net/PM7_accuracy/PM7_PDB/1RPW.pdb The Resolver thinks Pdb TRANSCRIPTION 03-DEC-03 1RPW CRYSTAL STRUCTURE OF THE MULTIDRUG BINDING PROTEIN QACR BOUND TO THE DIAMIDINE HEXAMIDINE found biomolecule 1: A, B biomolecule 1: number of transforms: 1 found biomolecule 2: C, D biomolecule 2: number of transforms: 1 found biomolecule 3: C found biomolecule 3: A, B, D biomolecule 3: number of transforms: 8 found biomolecule 4: C, D found biomolecule 4: A, B biomolecule 4: number of transforms: 8 found biomolecule 5: A, B, C, D biomolecule 5: number of transforms: 2 found biomolecule 6: A found biomolecule 6: C, D, B biomolecule 6: number of transforms: 4 found biomolecule 7: C found biomolecule 7: A, B, D biomolecule 7: number of transforms: 4 found biomolecule 8: A, B, C, D biomolecule 8: number of transforms: 2 found biomolecule 9: C, D found biomolecule 9: A, B biomolecule 9: number of transforms: 4 found biomolecule 10: A, B, C, D biomolecule 10: number of transforms: 1 found biomolecule 11: C, D found biomolecule 11: A, B biomolecule 11: number of transforms: 2 found biomolecule 12: C found biomolecule 12: A, B biomolecule 12: number of transforms: 8 found biomolecule 13: A, B, D biomolecule 13: number of transforms: 2 found biomolecule 14: C found biomolecule 14: A biomolecule 14: number of transforms: 4 found biomolecule 15: D, B biomolecule 15: number of transforms: 1 found biomolecule 16: D, B biomolecule 16: number of transforms: 2 found biomolecule 17: D, B biomolecule 17: number of transforms: 2 found biomolecule 18: C, D biomolecule 18: number of transforms: 2 found biomolecule 19: A, B biomolecule 19: number of transforms: 2 found biomolecule 20: C found biomolecule 20: A biomolecule 20: number of transforms: 2 Setting space group name to P 42 21 2 Time for openFile(../PM7_PDB/1RPW.pdb): 254 ms reading 6326 atoms ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false 1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them. Default Van der Waals type for model set to Babel 6326 atoms created ModelSet: autobonding; use autobond=false to not generate bonds automatically TRANSCRIPTION 03-DEC-03 1RPW CRYSTAL STRUCTURE OF THE MULTIDRUG BINDING PROTEIN QACR BOUND TO THE DIAMIDINE HEXAMIDINE found biomolecule 1: A, B found biomolecule 2: C, D found biomolecule 3: C found biomolecule 3: A, B, D found biomolecule 4: C, D found biomolecule 4: A, B found biomolecule 5: A, B, C, D found biomolecule 6: A found biomolecule 6: C, D, B found biomolecule 7: C found biomolecule 7: A, B, D found biomolecule 8: A, B, C, D found biomolecule 9: C, D found biomolecule 9: A, B found biomolecule 10: A, B, C, D found biomolecule 11: C, D found biomolecule 11: A, B found biomolecule 12: C found biomolecule 12: A, B found biomolecule 13: A, B, D found biomolecule 14: C found biomolecule 14: A found biomolecule 15: D, B found biomolecule 16: D, B found biomolecule 17: D, B found biomolecule 18: C, D found biomolecule 19: A, B found biomolecule 20: C found biomolecule 20: A 6370 connections deleted Standard Hbond calculation 420 hydrogen bonds measurementUnits = "angstroms" Jmol 14.4.0_2015.10.14 2015-10-14 19:01 DSSP analysis for model 1.1 - 1RPW W. Kabsch and C. Sander, Biopolymers, vol 22, 1983, pp 2577-2637 We thank Wolfgang Kabsch and Chris Sander for writing the DSSP software, and we thank the CMBI for maintaining it to the extent that it was easy to re-engineer for our purposes. At this point in time, we make no guarantee that this code gives precisely the same analysis as the code available via license from CMBI at http://swift.cmbi.ru.nl/gv/dssp All bioshapes have been deleted and must be regenerated. NOTE: Backbone amide hydrogen positions are present and will be ignored. Their positions will be approximated, as in standard DSSP analysis. Use SET dsspCalculateHydrogenAlways FALSE to not use this approximation. ------------------------------ 65.1.8: 1 65.1.7: 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 6 7 8 65.1.6: 123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456 65.1.5: ....................................................................................................................................>5555<................................................ 65.1.4: .>>4>XX>XXXXX<<<<.....>>>>X<<<<..>444<.....>>>>XXXXXXXXXXXXXXX<XX<4<<...>>>>XXXXXXXX<<<<.....>>>>XX<<<<....>4>><>X<>XX>XX<XXX>XXXXXX<<<<......>>>>XXXXXXXXXXX<<<<....>>>>XXXXXXXXXXXX<<<<. 65.1.3: .>>3<<...>33<.........>33<.>>3<<..>3><3<..........>33<....>33<.>33X>3<<...........>>3<<...>>3<<....>>><<<.................>>3<<...>33X33<.....>33<............>33X33<>33<..>33<.....>>3<<. 65.1.1: ..HHHHHHHHHHHHHH.......HHHHHHHT...TTTTT.....HHHHHHHHHHHHHHHHHHHHHHHHTT...HHHHHHHHHHHHHH....GGGHHHHHHHHTT....TTHHHHHHHHHHHHHHHHHHHHHHHHHTT......HHHHHHHHHHHHHHHHHT.TT..HHHHHHHHHHHHHHHHHH.. 65.1.0: NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLA 66.2.8: 2 3 66.2.7: 9 0 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 6 7 66.2.6: 789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012 66.2.5: ...........................>5555<....>5555<.........................................................................................>5555<................................................ 66.2.4: >>>>XXXXXXXXXX<<XX44<<>>>>X<<<<..>>>>XX<<<<>>>>XXXXXXXXXXXXXXXXX<<<<....>>>>XXXXXXXXXXX<<<<..>>>>XX<<X<44<.>>>>XXXXXXXXXX<XXX>XXXXX<<<<.......>>>>XXXXXXXXXXX<X<<4<..>>>>XXXXXXXXXXX<<<<.. 66.2.3: ......................>33<.>>3<<.................................>>><<<...........>33<.>>3<<>>3<<...>>3<X33<.>33X33<.....>>3<<......>>3<<.....>33X33<.........>33X33<>33<......>33<..>>3<< 66.2.1: .HHHHHHHHHHHHHHHHHHHH..HHHHHHHTT..HHHHHHHH..HHHHHHHHHHHHHHHHHHHHHHHGGG...HHHHHHHHHHHHHHHHHT..THHHHHHHHTTTTT.HHHHHHHHHHHHHHHHHHHHHHHHHHTTT......HHHHHHHHHHHHHHHHHTTTT..HHHHHHHHHHHHHHHHHTT. 66.2.0: NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLA SUMMARY: H : A:3_A:16 H : A:24_A:30 T : A:31_A:31 T : A:35_A:39 H : A:45_A:68 T : A:69_A:70 H : A:74_A:87 G : A:92_A:94 H : A:95_A:102 T : A:103_A:104 T : A:109_A:110 H : A:111_A:135 T : A:136_A:137 H : A:144_A:160 T : A:161_A:161 T : A:163_A:164 H : A:167_A:184 H : B:188_B:207 H : B:210_B:216 T : B:217_B:218 H : B:221_B:228 H : B:231_B:253 G : B:254_B:256 H : B:260_B:276 T : B:277_B:277 T : B:280_B:280 H : B:281_B:288 T : B:289_B:293 H : B:295_B:320 T : B:321_B:323 H : B:330_B:346 T : B:347_B:350 H : B:353_B:369 T : B:370_B:371 hermiteLevel = 4 ribbonAspectRatio = 12 Script completed Jmol script terminated loadClass J.g3d.HermiteRenderer |
Jmol._Canvas2D (Jmol) "jmolAppletPM7_3"[x] script 1 started FileManager.getAtomSetCollectionFromFile(../PM7_3/1RPW.pdb) FileManager opening url http://openmopac.net/PM7_accuracy/PM7_3/1RPW.pdb The Resolver thinks Pdb loadClass J.adapter.readers.pdb.PdbReader JSmol exec jmolAppletPM6_3 start applet null Jmol JavaScript applet jmolAppletPM6_3__5115341949879686__ initializing Jmol getValue debug null Jmol getValue logLevel null Jmol getValue allowjavascript null AppletRegistry.checkIn(jmolAppletPM6_3__5115341949879686__) nographics false nographics false headless false vwrOptions: { "name":"jmolAppletPM6_3","applet":true,"documentBase":"http://openmopac.net/PM7_accuracy/PM7_proteins/1RPW_3.html","platform":"J.awtjs2d.Platform","fullName":"jmolAppletPM6_3__5115341949879686__","codePath":"http://openmopac.net/PM7_accuracy/PM7_proteins/../../jsmol/j2s/","display":"jmolAppletPM6_3_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"5115341949879686","bgcolor":"#000000" } setting document base to "http://openmopac.net/PM7_accuracy/PM7_proteins/1RPW_3.html" (C) 2015 Jmol Development Jmol Version: 14.4.0_2015.10.14 2015-10-14 19:01 java.vendor: Java2Script (HTML5) java.version: 2015-09-19 23:29:54 (JSmol/j2s) os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com) Access: ALL memory: 0.0/0.0 processors available: 1 useCommandThread: false appletId:jmolAppletPM6_3 (signed) Jmol getValue emulate null defaults = "Jmol" Jmol getValue boxbgcolor null Jmol getValue bgcolor #000000 backgroundColor = "#000000" Jmol getValue ANIMFRAMECallback null Jmol getValue APPLETREADYCallback Jmol._readyCallback APPLETREADYCallback = "Jmol._readyCallback" callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY Jmol getValue ATOMMOVEDCallback null Jmol getValue CLICKCallback null Jmol getValue DRAGDROPCallback null Jmol getValue ECHOCallback null Jmol getValue ERRORCallback null Jmol getValue EVALCallback null Jmol getValue HOVERCallback null Jmol getValue IMAGECallback null Jmol getValue LOADSTRUCTCallback null Jmol getValue MEASURECallback null Jmol getValue MESSAGECallback null Jmol getValue MINIMIZATIONCallback null Jmol getValue SERVICECallback null Jmol getValue PICKCallback null Jmol getValue RESIZECallback null Jmol getValue SCRIPTCallback null Jmol getValue SYNCCallback null Jmol getValue STRUCTUREMODIFIEDCallback null Jmol getValue doTranslate null language=en_US Jmol getValue popupMenu null Jmol getValue script null Jmol getValue loadInline null Jmol getValue load null Jmol applet jmolAppletPM6_3__5115341949879686__ ready |
Jmol._Canvas2D (Jmol) "jmolAppletPM6_3"[x] loadClass core.package loadClass java.lang.String loadClass core.package JSmol exec jmolAppletPM7_PDB start applet null Jmol JavaScript applet jmolAppletPM7_PDB__5115341949879686__ initializing Jmol getValue debug null Jmol getValue logLevel null Jmol getValue allowjavascript null AppletRegistry.checkIn(jmolAppletPM7_PDB__5115341949879686__) nographics false nographics false headless false vwrOptions: { "name":"jmolAppletPM7_PDB","applet":true,"documentBase":"http://openmopac.net/PM7_accuracy/PM7_proteins/1RPW_3.html","platform":"J.awtjs2d.Platform","fullName":"jmolAppletPM7_PDB__5115341949879686__","codePath":"http://openmopac.net/PM7_accuracy/PM7_proteins/../../jsmol/j2s/","display":"jmolAppletPM7_PDB_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"5115341949879686","bgcolor":"#000000" } setting document base to "http://openmopac.net/PM7_accuracy/PM7_proteins/1RPW_3.html" (C) 2015 Jmol Development Jmol Version: 14.4.0_2015.10.14 2015-10-14 19:01 java.vendor: Java2Script (HTML5) java.version: 2015-09-19 23:29:54 (JSmol/j2s) os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com) Access: ALL memory: 0.0/0.0 processors available: 1 useCommandThread: false appletId:jmolAppletPM7_PDB (signed) loadClass JS.ScriptManager JSmol exec jmolAppletPM7_3 start applet null Jmol JavaScript applet jmolAppletPM7_3__5115341949879686__ initializing Jmol getValue debug null Jmol getValue logLevel null Jmol getValue allowjavascript null AppletRegistry.checkIn(jmolAppletPM7_3__5115341949879686__) nographics false nographics false headless false vwrOptions: { "name":"jmolAppletPM7_3","applet":true,"documentBase":"http://openmopac.net/PM7_accuracy/PM7_proteins/1RPW_3.html","platform":"J.awtjs2d.Platform","fullName":"jmolAppletPM7_3__5115341949879686__","codePath":"http://openmopac.net/PM7_accuracy/PM7_proteins/../../jsmol/j2s/","display":"jmolAppletPM7_3_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"5115341949879686","bgcolor":"#000000" } setting document base to "http://openmopac.net/PM7_accuracy/PM7_proteins/1RPW_3.html" (C) 2015 Jmol Development Jmol Version: 14.4.0_2015.10.14 2015-10-14 19:01 java.vendor: Java2Script (HTML5) java.version: 2015-09-19 23:29:54 (JSmol/j2s) os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com) Access: ALL memory: 0.0/0.0 processors available: 1 useCommandThread: false appletId:jmolAppletPM7_3 (signed) Jmol getValue emulate null defaults = "Jmol" Jmol getValue boxbgcolor null Jmol getValue bgcolor #000000 backgroundColor = "#000000" Jmol getValue ANIMFRAMECallback null Jmol getValue APPLETREADYCallback Jmol._readyCallback APPLETREADYCallback = "Jmol._readyCallback" callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY Jmol getValue ATOMMOVEDCallback null Jmol getValue CLICKCallback null Jmol getValue DRAGDROPCallback null Jmol getValue ECHOCallback null Jmol getValue ERRORCallback null Jmol getValue EVALCallback null Jmol getValue HOVERCallback null Jmol getValue IMAGECallback null Jmol getValue LOADSTRUCTCallback null Jmol getValue MEASURECallback null Jmol getValue MESSAGECallback null Jmol getValue MINIMIZATIONCallback null Jmol getValue SERVICECallback null Jmol getValue PICKCallback null Jmol getValue RESIZECallback null Jmol getValue SCRIPTCallback null Jmol getValue SYNCCallback null Jmol getValue STRUCTUREMODIFIEDCallback null Jmol getValue doTranslate null language=en_US Jmol getValue popupMenu null Jmol getValue script null Jmol getValue loadInline null Jmol getValue load null Jmol applet jmolAppletPM7_3__5115341949879686__ ready script 1 started FileManager.getAtomSetCollectionFromFile(../PM6_3/1RPW.pdb) FileManager opening url http://openmopac.net/PM7_accuracy/PM6_3/1RPW.pdb The Resolver thinks Pdb TRANSCRIPTION 03-DEC-03 1RPW CRYSTAL STRUCTURE OF THE MULTIDRUG BINDING PROTEIN QACR BOUND TO THE DIAMIDINE HEXAMIDINE found biomolecule 1: A, B biomolecule 1: number of transforms: 1 found biomolecule 2: C, D biomolecule 2: number of transforms: 1 found biomolecule 3: C found biomolecule 3: A, B, D biomolecule 3: number of transforms: 8 found biomolecule 4: C, D found biomolecule 4: A, B biomolecule 4: number of transforms: 8 found biomolecule 5: A, B, C, D biomolecule 5: number of transforms: 2 found biomolecule 6: A found biomolecule 6: C, D, B biomolecule 6: number of transforms: 4 found biomolecule 7: C found biomolecule 7: A, B, D biomolecule 7: number of transforms: 4 found biomolecule 8: A, B, C, D biomolecule 8: number of transforms: 2 found biomolecule 9: C, D found biomolecule 9: A, B biomolecule 9: number of transforms: 4 found biomolecule 10: A, B, C, D biomolecule 10: number of transforms: 1 found biomolecule 11: C, D found biomolecule 11: A, B biomolecule 11: number of transforms: 2 found biomolecule 12: C found biomolecule 12: A, B biomolecule 12: number of transforms: 8 found biomolecule 13: A, B, D biomolecule 13: number of transforms: 2 found biomolecule 14: C found biomolecule 14: A biomolecule 14: number of transforms: 4 found biomolecule 15: D, B biomolecule 15: number of transforms: 1 found biomolecule 16: D, B biomolecule 16: number of transforms: 2 found biomolecule 17: D, B biomolecule 17: number of transforms: 2 found biomolecule 18: C, D biomolecule 18: number of transforms: 2 found biomolecule 19: A, B biomolecule 19: number of transforms: 2 found biomolecule 20: C found biomolecule 20: A biomolecule 20: number of transforms: 2 Setting space group name to P 42 21 2 Time for openFile(../PM6_3/1RPW.pdb): 208 ms reading 6326 atoms ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false 1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them. Default Van der Waals type for model set to Babel 6326 atoms created ModelSet: autobonding; use autobond=false to not generate bonds automatically TRANSCRIPTION 03-DEC-03 1RPW CRYSTAL STRUCTURE OF THE MULTIDRUG BINDING PROTEIN QACR BOUND TO THE DIAMIDINE HEXAMIDINE found biomolecule 1: A, B found biomolecule 2: C, D found biomolecule 3: C found biomolecule 3: A, B, D found biomolecule 4: C, D found biomolecule 4: A, B found biomolecule 5: A, B, C, D found biomolecule 6: A found biomolecule 6: C, D, B found biomolecule 7: C found biomolecule 7: A, B, D found biomolecule 8: A, B, C, D found biomolecule 9: C, D found biomolecule 9: A, B found biomolecule 10: A, B, C, D found biomolecule 11: C, D found biomolecule 11: A, B found biomolecule 12: C found biomolecule 12: A, B found biomolecule 13: A, B, D found biomolecule 14: C found biomolecule 14: A found biomolecule 15: D, B found biomolecule 16: D, B found biomolecule 17: D, B found biomolecule 18: C, D found biomolecule 19: A, B found biomolecule 20: C found biomolecule 20: A loadClass JS.MathExt loadClass JS.CmdExt 6369 connections deleted Standard Hbond calculation 435 hydrogen bonds measurementUnits = "angstroms" Jmol 14.4.0_2015.10.14 2015-10-14 19:01 DSSP analysis for model 1.1 - 1RPW W. Kabsch and C. Sander, Biopolymers, vol 22, 1983, pp 2577-2637 We thank Wolfgang Kabsch and Chris Sander for writing the DSSP software, and we thank the CMBI for maintaining it to the extent that it was easy to re-engineer for our purposes. At this point in time, we make no guarantee that this code gives precisely the same analysis as the code available via license from CMBI at http://swift.cmbi.ru.nl/gv/dssp All bioshapes have been deleted and must be regenerated. NOTE: Backbone amide hydrogen positions are present and will be ignored. Their positions will be approximated, as in standard DSSP analysis. Use SET dsspCalculateHydrogenAlways FALSE to not use this approximation. ------------------------------ 65.1.8: 1 65.1.7: 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 6 7 8 65.1.6: 123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456 65.1.5: ...........................>5555<.............................................................................>5555<................>5555<................................................ 65.1.4: .>>4>XX>XXXXX<<<<>444<>>>>X<<<<..>444<.....>>>>XXXXXXXXXXXXXXX<XX<4<<...>>>>XXXXXX<X<<4<.....>>>>XX<<X<44<.>>>><XX<>XX>XX<XXX>XXXXXX<<<<......>>>>XXXXXXXXXXX<<<<....>>>>XXXXXXXXXXX<<<<.. 65.1.3: .>33<.................>33<..>33<..>3><3<...>33<................>33X>3<<...........>>3<<...>>3<<.....>>3<X33<........>33<..>33<....>33X33<...>3><3<.............>3><3<>33<............>>3<< 65.1.1: ..HHHHHHHHHHHHHH..TTT..HHHHHHHTT..TTTTT.....HHHHHHHHHHHHHHHHHHHHHHHHTT...HHHHHHHHHHHHTT....GGGHHHHHHHHTTTTT.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT....TTHHHHHHHHHHHHHHHHHTTTT..HHHHHHHHHHHHHHHHHTT. 65.1.0: NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLA 66.2.8: 2 3 66.2.7: 9 0 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 6 7 66.2.6: 789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789012 66.2.5: ...........................>5555<....>5555<.........................................................................................>5555<................................................ 66.2.4: >>>>XXXXXXXXXX<<XX44<<>>>>X<<<<..>>>>XX<<<<>>>>XXXXXXXXXXXXXXXXX<<<<....>>>>XXXXXXXXXXX<<<<..>>>>XX<XX<4<<.>>>>XXXXXXXXXX<XXX>XXXXXX<<<<......>>>>XXXXXXXXXXX<X<<4<..>>>>XXXXXXXXXXX<<<<.. 66.2.3: >33<........................>33<.................................>>><<<................>>3<X>><<<...>>3<X33X33<.>33<.....>>3<<.......>33<.....>33<............>33X33<>33<............>>3<< 66.2.1: .HHHHHHHHHHHHHHHHHHHH..HHHHHHHTT..HHHHHHHH..HHHHHHHHHHHHHHHHHHHHHHHGGG...HHHHHHHHHHHHHHHHHT.TTHHHHHHHHHHHTT.HHHHHHHHHHHHHHHHHHHHHHHHHHHTT......HHHHHHHHHHHHHHHHHTTTT..HHHHHHHHHHHHHHHHHTT. 66.2.0: NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLA SUMMARY: H : A:3_A:16 T : A:19_A:21 H : A:24_A:30 T : A:31_A:32 T : A:35_A:39 H : A:45_A:68 T : A:69_A:70 H : A:74_A:85 T : A:86_A:87 G : A:92_A:94 H : A:95_A:102 T : A:103_A:107 H : A:109_A:135 T : A:136_A:137 T : A:142_A:143 H : A:144_A:160 T : A:161_A:164 H : A:167_A:183 T : A:184_A:185 H : B:188_B:207 H : B:210_B:216 T : B:217_B:218 H : B:221_B:228 H : B:231_B:253 G : B:254_B:256 H : B:260_B:276 T : B:277_B:277 T : B:279_B:280 H : B:281_B:291 T : B:292_B:293 H : B:295_B:321 T : B:322_B:323 H : B:330_B:346 T : B:347_B:350 H : B:353_B:369 T : B:370_B:371 hermiteLevel = 4 ribbonAspectRatio = 12 Script completed Jmol script terminated TRANSCRIPTION 03-DEC-03 1RPW CRYSTAL STRUCTURE OF THE MULTIDRUG BINDING PROTEIN QACR BOUND TO THE DIAMIDINE HEXAMIDINE found biomolecule 1: A, B biomolecule 1: number of transforms: 1 found biomolecule 2: C, D biomolecule 2: number of transforms: 1 found biomolecule 3: C found biomolecule 3: A, B, D biomolecule 3: number of transforms: 8 found biomolecule 4: C, D found biomolecule 4: A, B biomolecule 4: number of transforms: 8 found biomolecule 5: A, B, C, D biomolecule 5: number of transforms: 2 found biomolecule 6: A found biomolecule 6: C, D, B biomolecule 6: number of transforms: 4 found biomolecule 7: C found biomolecule 7: A, B, D biomolecule 7: number of transforms: 4 found biomolecule 8: A, B, C, D biomolecule 8: number of transforms: 2 found biomolecule 9: C, D found biomolecule 9: A, B biomolecule 9: number of transforms: 4 found biomolecule 10: A, B, C, D biomolecule 10: number of transforms: 1 found biomolecule 11: C, D found biomolecule 11: A, B biomolecule 11: number of transforms: 2 found biomolecule 12: C found biomolecule 12: A, B biomolecule 12: number of transforms: 8 found biomolecule 13: A, B, D biomolecule 13: number of transforms: 2 found biomolecule 14: C found biomolecule 14: A biomolecule 14: number of transforms: 4 found biomolecule 15: D, B biomolecule 15: number of transforms: 1 found biomolecule 16: D, B biomolecule 16: number of transforms: 2 found biomolecule 17: D, B biomolecule 17: number of transforms: 2 found biomolecule 18: C, D biomolecule 18: number of transforms: 2 found biomolecule 19: A, B biomolecule 19: number of transforms: 2 found biomolecule 20: C found biomolecule 20: A biomolecule 20: number of transforms: 2 Setting space group name to P 42 21 2 Time for openFile(../PM7_3/1RPW.pdb): 1326 ms reading 6326 atoms ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false 1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them. Default Van der Waals type for model set to Babel 6326 atoms created ModelSet: autobonding; use autobond=false to not generate bonds automatically TRANSCRIPTION 03-DEC-03 1RPW CRYSTAL STRUCTURE OF THE MULTIDRUG BINDING PROTEIN QACR BOUND TO THE DIAMIDINE HEXAMIDINE found biomolecule 1: A, B found biomolecule 2: C, D found biomolecule 3: C found biomolecule 3: A, B, D found biomolecule 4: C, D found biomolecule 4: A, B found biomolecule 5: A, B, C, D found biomolecule 6: A found biomolecule 6: C, D, B found biomolecule 7: C found biomolecule 7: A, B, D found biomolecule 8: A, B, C, D found biomolecule 9: C, D found biomolecule 9: A, B found biomolecule 10: A, B, C, D found biomolecule 11: C, D found biomolecule 11: A, B found biomolecule 12: C found biomolecule 12: A, B found biomolecule 13: A, B, D found biomolecule 14: C found biomolecule 14: A found biomolecule 15: D, B found biomolecule 16: D, B found biomolecule 17: D, B found biomolecule 18: C, D found biomolecule 19: A, B found biomolecule 20: C found biomolecule 20: A Jmol getValue emulate null defaults = "Jmol" Jmol getValue boxbgcolor null Jmol getValue bgcolor #000000 backgroundColor = "#000000" Jmol getValue ANIMFRAMECallback null Jmol getValue APPLETREADYCallback Jmol._readyCallback APPLETREADYCallback = "Jmol._readyCallback" callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY Jmol getValue ATOMMOVEDCallback null Jmol getValue CLICKCallback null Jmol getValue DRAGDROPCallback null Jmol getValue ECHOCallback null Jmol getValue ERRORCallback null Jmol getValue EVALCallback null Jmol getValue HOVERCallback null Jmol getValue IMAGECallback null Jmol getValue LOADSTRUCTCallback null Jmol getValue MEASURECallback null Jmol getValue MESSAGECallback null Jmol getValue MINIMIZATIONCallback null Jmol getValue SERVICECallback null Jmol getValue PICKCallback null Jmol getValue RESIZECallback null Jmol getValue SCRIPTCallback null Jmol getValue SYNCCallback null Jmol getValue STRUCTUREMODIFIEDCallback null Jmol getValue doTranslate null language=en_US Jmol getValue popupMenu null Jmol getValue script null Jmol getValue loadInline null Jmol getValue load null Jmol applet jmolAppletPM7_PDB__5115341949879686__ ready |